Soren Learning

Soren Learning

A personal collection of technical notes, product thinking, design principles, and growth frameworks.

Categories

Series

Design Systems from a Code Perspective

A 7-chapter, engineering-first guide to building, shipping, and migrating to a design system — tokens, component APIs, Storybook, versioning, dark mode, and the migration playbook — using React + Tailwind + shadcn/ui.

7 chapters

design-systemfrontendreacttailwind
Start reading

UX Fundamentals for Developers

An 8-chapter, opinionated guide to the parts of UX a developer can actually control — heuristics, information architecture, typography, color, forms, and the states everyone forgets — with real code in React + Tailwind.

8 chapters

uxdesignfrontendaccessibility
Start reading

Career Growth in Tech

The practical guide to managing your career in tech — from acing performance reviews and negotiating offers, to building a personal brand, networking as an introvert, and knowing when to stay or leave.

6 chapters

career-growthperformance-reviewpersonal-brandingnetworking
Start reading

Communication for Engineers

A practical series on the communication skills that determine how much of your technical work actually lands. Seven chapters on async updates, presentations, remote etiquette, meetings, documentation, conflict, and cross-cultural collaboration.

7 chapters

communicationsoft-skillsremote-workasync-communication
Start reading

Deep Work & Productivity for Engineers

How to do your best technical work consistently — protecting focus, building knowledge systems, managing the hidden costs of interruption, and recovering when you push too hard for too long.

5 chapters

deep-workproductivityflow-stateburnout
Start reading

The Senior Engineer Playbook

The practical guide to operating at senior level — from the mindset shift that separates senior from mid-level, to the specific skills that get engineers to Staff and beyond. Six chapters on leadership, communication, scope, influence, and feedback.

6 chapters

senior-engineersengineering-leadershipcareer-growthsoft-skills
Start reading

Business Acumen for Senior Engineers

A working engineer's guide to operating literacy — reading a P&L, understanding unit economics, mapping business models to architecture, cost-aware engineering, stakeholder mapping, and presenting technical work to non-technical audiences.

6 chapters

business-acumensenior-engineersleadershipcareer-growth
Start reading

From Engineer to Product Thinker

The mindset shift from executing specs to shaping them. Eight chapters on the day-to-day craft of thinking like a product person while staying an engineer — from JTBD and PRD reading to graceful pushback and outcome-driven work.

8 chapters

product-mindsetsenior-engineersengineering-leadershipcareer-growth
Start reading

The Pragmatic Guide to Scrum: Foundations of Agile Delivery

An overview of Agile principles and the Scrum framework, focusing on the roles and values that drive successful product development.

5 chapters

lean-methodologyagilescrumdecision-making
Start reading

Product Discovery for Engineers

A working engineer's guide to product discovery — user interviews, data-informed decisions, A/B testing, feature flags, shadow and canary launches, and kill criteria. The practices that turn engineers into builders of the right thing.

6 chapters

product-discoveryexperimentationab-testingfeature-flags
Start reading

Anthropic

Deep dives into Anthropic's tools, models, and workflows for building AI-powered products.

2 chapters

anthropicclaudeaiproductivity
Start reading

Auth in Depth: From Passwords to Zero Trust

A complete 16-chapter journey from authentication fundamentals to zero trust architecture — covering JWT, OAuth 2.0, OIDC, RBAC, ABAC, MFA, and real-world security patterns.

16 chapters

SecurityAuthenticationAuthorizationOAuth2
Start reading

Design Patterns in Kotlin: A Practical Guide

A complete 5-chapter series covering all 23 Gang of Four design patterns through a practical Kotlin lens — with real-world examples from Spring, OkHttp, Android, and Jetpack Compose.

5 chapters

design-patternskotlinoopsoftware-engineering
Start reading

Docker in Depth: From Basics to Orchestration

A 9-chapter series taking you from zero Docker knowledge through containers, images, networking, volumes, Compose, security, CI/CD, and orchestration — everything you need to run Docker confidently in production.

9 chapters

dockercontainersdevopsci-cd
Start reading

Domain-Driven Design: Building Software That Speaks Business

A 6-chapter journey from DDD philosophy through strategic design, tactical building blocks, and real-world architecture — the definitive guide to modeling complex domains.

6 chapters

DDDSystemDesignSoftwareArchitectureCleanArchitecture
Start reading

Software Testing: From Fundamentals to Modern Practice

A practical, engineer-focused guide to software testing — the testing pyramid, TDD/BDD, automation strategy, CI/CD integration, security testing, and modern AI-assisted practices.

7 chapters

testingqatddautomation
Start reading

Terraform on AWS: From Zero to Production

A 6-chapter, AWS-first path from your first terraform apply to running Terraform safely in production — with state management, modules, CI/CD, and policy-as-code as a single connected story.

6 chapters

terraformawsinfrastructure-as-codedevops
Start reading

Recent Posts

PostHog's Architecture: What Kafka, ClickHouse, and Feature Flags Teach You

Skip the product pitch. PostHog is worth studying for its ingestion pipeline and its feature-flag latency fix — two patterns worth stealing whether or not you ever touch the product.

Jul 6, 2026system-designdistributed-systemsmessaging

The OWASP Top 10:2025 Update: What Changed and Why It Matters

OWASP quietly replaced the 2021 Top 10 in November 2025. SSRF disappeared, misconfiguration jumped to #2, and supply chain got its own top-3 slot — here's the diff.

Jul 2, 2026securityowaspappsec

The Outbox Pattern: Solving the Dual-Write Problem

Every microservice eventually hits the dual-write trap. The outbox pattern is the right fix — but it moves complexity from your application code into your infrastructure.

Jun 30, 2026system-designmicroservicesdistributed-systems

Service-to-Service Authentication: The Threat Model You're Ignoring

Most microservices deployments skip internal auth entirely. Here's what that costs you, and the three patterns that fix it.

Jun 24, 2026microservicessecurityauthentication

HyperLogLog: Count Billions with 12 KB

How a single probabilistic trick lets you estimate 10⁹ unique elements using less memory than a thumbnail image.

Jun 17, 2026algorithmsredissystem-design

Bloom Filter: The Structure That Never Lies About Absence

How a bit array and k hash functions let you test set membership with zero false negatives, tunable false positives, and 1.14 MB for a million elements.

Jun 17, 2026algorithmsredisdatabases

Tags

AuthenticationAuthorizationBackendCareer GrowthClean CodeCleanArchitectureCloudCommand LineCommunicationConcurrencyDDDDatabasesDevOpsDockerJWTKubernetesLeadershipLearningLinuxMental HealthMicroservicesNetworkingOAuth2RefactoringSecuritySenior EngineerSoft SkillsSoftware EngineeringSoftwareArchitectureSysadminSystem DesignSystemDesignTDDTeamworkTerminalTestingZeroTrustab-testingaccessibilityagileaialgorithmsanalyticsanthropicappsecarchitectureasync-communicationauthenticationautomationawsbackendbehavioralbuild-vs-buyburnoutbusiness-acumenbusiness-impactcareercareer-growthci-cdclaudeclean-architectureclean-codecode-reviewcollaborationcommunicationcontainerscontext-switchingdatabasesdecision-makingdeep-workdesigndesign-patternsdesign-systemdeveloper-experiencedevopsdistributed-systemsdockerengineering-cultureengineering-leadershipengineering-managementengineering-qualityengineering-strategyexperimentationfeature-flagsfinance-for-engineersflow-statefrontendhexagonal-architectureinfrastructure-as-codeinterviewjob-searchkanbankotlinkubernetesleadershiplean-methodologylearningllmmental-modelsmessagingmetricsmicroservicesmtlsnetworkingnorth-star-metricnote-takingooporchestrationoutcome-drivenowaspperformance-reviewpersonal-brandingports-and-adaptersprdprobabilistic-data-structuresproduct-discoveryproduct-mindsetproduct-thinkingproductivityprogressive-deliveryprotocolqareactredisreliabilityremote-workrequirementssalary-negotiationscrumsecuritysenior-engineerssoft-skillssoftware-designsoftware-engineeringstaff-engineersupply-chainsystem-designtailwindtddtechnical-debttechnical-decisionstechnical-leadershiptechnical-writingterraformtestingtheory-of-constraintsuser-researchuxwcagweb-security