Soren Learning

Soren Learning

A personal collection of technical notes, product thinking, design principles, and growth frameworks.

Categories

Series

Design Systems from a Code Perspective

A 7-chapter, engineering-first guide to building, shipping, and migrating to a design system — tokens, component APIs, Storybook, versioning, dark mode, and the migration playbook — using React + Tailwind + shadcn/ui.

7 chapters

design-systemfrontendreacttailwind
Start reading

UX Fundamentals for Developers

An 8-chapter, opinionated guide to the parts of UX a developer can actually control — heuristics, information architecture, typography, color, forms, and the states everyone forgets — with real code in React + Tailwind.

8 chapters

uxdesignfrontendaccessibility
Start reading

Career Growth in Tech

The practical guide to managing your career in tech — from acing performance reviews and negotiating offers, to building a personal brand, networking as an introvert, and knowing when to stay or leave.

6 chapters

career-growthperformance-reviewpersonal-brandingnetworking
Start reading

Communication for Engineers

A practical series on the communication skills that determine how much of your technical work actually lands. Seven chapters on async updates, presentations, remote etiquette, meetings, documentation, conflict, and cross-cultural collaboration.

7 chapters

communicationsoft-skillsremote-workasync-communication
Start reading

Deep Work & Productivity for Engineers

How to do your best technical work consistently — protecting focus, building knowledge systems, managing the hidden costs of interruption, and recovering when you push too hard for too long.

5 chapters

deep-workproductivityflow-stateburnout
Start reading

The Senior Engineer Playbook

The practical guide to operating at senior level — from the mindset shift that separates senior from mid-level, to the specific skills that get engineers to Staff and beyond. Six chapters on leadership, communication, scope, influence, and feedback.

6 chapters

senior-engineersengineering-leadershipcareer-growthsoft-skills
Start reading

Business Acumen for Senior Engineers

A working engineer's guide to operating literacy — reading a P&L, understanding unit economics, mapping business models to architecture, cost-aware engineering, stakeholder mapping, and presenting technical work to non-technical audiences.

6 chapters

business-acumensenior-engineersleadershipcareer-growth
Start reading

From Engineer to Product Thinker

The mindset shift from executing specs to shaping them. Eight chapters on the day-to-day craft of thinking like a product person while staying an engineer — from JTBD and PRD reading to graceful pushback and outcome-driven work.

8 chapters

product-mindsetsenior-engineersengineering-leadershipcareer-growth
Start reading

The Pragmatic Guide to Scrum: Foundations of Agile Delivery

An overview of Agile principles and the Scrum framework, focusing on the roles and values that drive successful product development.

5 chapters

lean-methodologyagilescrumdecision-making
Start reading

Product Discovery for Engineers

A working engineer's guide to product discovery — user interviews, data-informed decisions, A/B testing, feature flags, shadow and canary launches, and kill criteria. The practices that turn engineers into builders of the right thing.

6 chapters

product-discoveryexperimentationab-testingfeature-flags
Start reading

Anthropic

Deep dives into Anthropic's tools, models, and workflows for building AI-powered products.

2 chapters

anthropicclaudeaiproductivity
Start reading

Auth in Depth: From Passwords to Zero Trust

A complete 16-chapter journey from authentication fundamentals to zero trust architecture — covering JWT, OAuth 2.0, OIDC, RBAC, ABAC, MFA, and real-world security patterns.

16 chapters

SecurityAuthenticationAuthorizationOAuth2
Start reading

Design Patterns in Kotlin: A Practical Guide

A complete 5-chapter series covering all 23 Gang of Four design patterns through a practical Kotlin lens — with real-world examples from Spring, OkHttp, Android, and Jetpack Compose.

5 chapters

design-patternskotlinoopsoftware-engineering
Start reading

Docker in Depth: From Basics to Orchestration

A 6-chapter series taking you from Docker fundamentals through networking, Compose, security, CI/CD pipelines, and container orchestration — everything you need to run Docker confidently in production.

6 chapters

dockercontainersdevopsci-cd
Start reading

Domain-Driven Design: Building Software That Speaks Business

A 6-chapter journey from DDD philosophy through strategic design, tactical building blocks, and real-world architecture — the definitive guide to modeling complex domains.

6 chapters

DDDSystemDesignSoftwareArchitectureCleanArchitecture
Start reading

Software Testing: From Fundamentals to Modern Practice

A practical, engineer-focused guide to software testing — the testing pyramid, TDD/BDD, automation strategy, CI/CD integration, security testing, and modern AI-assisted practices.

7 chapters

testingqatddautomation
Start reading

Terraform on AWS: From Zero to Production

A 6-chapter, AWS-first path from your first terraform apply to running Terraform safely in production — with state management, modules, CI/CD, and policy-as-code as a single connected story.

6 chapters

terraformawsinfrastructure-as-codedevops
Start reading

Recent Posts

RESP: The Wire Protocol Behind Every Redis Command

A byte-level walkthrough of the Redis Serialization Protocol — how commands travel over the wire, why pipelining works, and what RESP3 changes for client-side caching.

May 19, 2026redisprotocolnetworking

Martin Fowler on LLMs: Six Things Worth Taking Seriously

A synthesis of Martin Fowler's August 2025 essay on LLMs and software development — covering workflow gaps, hallucinations as a feature, the Lethal Trifecta security risk, and why non-determinism changes everything.

May 19, 2026aillmsoftware-engineering

Theory of Constraints in Software Development

Your team is always busy but never fast. Theory of Constraints explains why — and gives you a five-step diagnostic that underlies Kanban, DevOps, and The Phoenix Project.

May 19, 2026theory-of-constraintsproductivitydevops

60 Linux Commands You Need to Know

A comprehensive reference guide to 60 essential Linux commands — from file navigation and user management to networking, processes, and system monitoring. Covers syntax, practical examples, and real-world usage patterns.

May 5, 2026LinuxCommand LineTerminal

Optimistic vs Pessimistic Locking: Choosing the Right Concurrency Strategy

Two ways to handle concurrent writes — lock first and ask questions later, or assume conflicts are rare and detect them at commit. When to use which, with concrete SQL and code.

Apr 29, 2026DatabasesConcurrencySystem Design

Every Networking Concept Explained: From a Single Server to Kubernetes

A condensed walkthrough of networking — IP, DNS, ports, subnets, NAT, VPC, Docker, and Kubernetes — by following how a real application grows.

Apr 29, 2026NetworkingDevOpsCloud

Tags

AuthenticationAuthorizationBackendCareer GrowthClean CodeCleanArchitectureCloudCommand LineCommunicationConcurrencyDDDDatabasesDevOpsDockerJWTKubernetesLeadershipLearningLinuxMental HealthMicroservicesNetworkingOAuth2RefactoringSecuritySenior EngineerSoft SkillsSoftware EngineeringSoftwareArchitectureSysadminSystem DesignSystemDesignTDDTeamworkTerminalTestingZeroTrustab-testingaccessibilityagileaianthropicarchitectureasync-communicationautomationawsbackendbuild-vs-buyburnoutbusiness-acumenbusiness-impactcareer-growthci-cdclaudeclean-architectureclean-codecode-reviewcollaborationcommunicationcontainerscontext-switchingdatabasesdecision-makingdeep-workdesigndesign-patternsdesign-systemdeveloper-experiencedevopsdockerengineering-cultureengineering-leadershipengineering-managementengineering-qualityengineering-strategyexperimentationfeature-flagsfinance-for-engineersflow-statefrontendhexagonal-architectureinfrastructure-as-codekanbankotlinkubernetesleadershiplean-methodologylearningllmmental-modelsmetricsnetworkingnorth-star-metricnote-takingooporchestrationoutcome-drivenperformance-reviewpersonal-brandingports-and-adaptersprdproduct-discoveryproduct-mindsetproduct-thinkingproductivityprogressive-deliveryprotocolqareactredisremote-workrequirementssalary-negotiationscrumsecuritysenior-engineerssoft-skillssoftware-designsoftware-engineeringstaff-engineersystem-designtailwindtddtechnical-debttechnical-decisionstechnical-leadershiptechnical-writingterraformtestingtheory-of-constraintsuser-researchuxwcag